Protein Info for H281DRAFT_04598 in Paraburkholderia bryophila 376MFSha3.1

Annotation: putative toxin-antitoxin system toxin component, PIN family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF13470: PIN_3" amino acids 12 to 126 (115 residues), 89 bits, see alignment E=3.8e-29 TIGR00305: putative toxin-antitoxin system toxin component, PIN family" amino acids 12 to 130 (119 residues), 47.1 bits, see alignment E=1.3e-16 PF01850: PIN" amino acids 13 to 89 (77 residues), 31.5 bits, see alignment E=2.5e-11

Best Hits

KEGG orthology group: None (inferred from 78% identity to bug:BC1001_1115)

Predicted SEED Role

"FIG00452560: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>H281DRAFT_04598 putative toxin-antitoxin system toxin component, PIN family (Paraburkholderia bryophila 376MFSha3.1)
MPGSHASHDALRVVLDSNVWIDILVFDDPHTRPIRAALENGTLAAVIDARCLAELTYVLD
YPQFAGRNVDKSAALAVVARLAQMVEVVAELDDPRPLPKCKDRDDQKFLELAHAARADWL
VSKDRAVLKLAKRVARDFGFQIAQPAPFAALLTGLVSGSTSGAAAPAESPV