Protein Info for H281DRAFT_04594 in Paraburkholderia bryophila 376MFSha3.1

Updated annotation (from data): putative oxepin-CoA hydrolase (EC 3.3.2.12)
Rationale: H281DRAFT_04594 is specifically important for phenylacetate utilization via the oxygenase pathway. This pathway requires an oxepin-CoA hydrolase, which is often provided by a (R)-specific enoyl-CoA hydratase (R-ECH) domain which is fused to 3-oxo-5,6-didehydrosuberyl-CoA semialdehyde dehydrogenase ("PaaZ"). But P. bryophila has a PacL-like semialdehyde dehydrogenase (H281DRAFT_05724), which lacks the R-ECH domain. H281DRAFT_04594 has an (S)-specific ECH domain and is probably the missing oxepin-CoA hydrolase. (There are no chiral centers in the oxepin-CoA reaction.) H281DRAFT_04594 is also related to paaF (2,3-dehydroadipyl-CoA hydratase), but that activity is probably provided by H281DRAFT_05725.
Original annotation: short chain enoyl-CoA hydratase /Enoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 13 to 262 (250 residues), 193.2 bits, E=5.3e-61
• PF16113: ECH_2
  • amino acids 18 to 186 (169 residues), 99.7 bits, E=2.4e-32

Best Hits

Swiss-Prot: 32% identical to PAAF_ECOLI: 2,3-dehydroadipyl-CoA hydratase (paaF) from Escherichia coli (strain K12)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 95% identity to bgf:BC1003_2293)

MetaCyc: 100% identical to oxepin-CoA hydrolase (Paraburkholderia caledonica)
RXNMETA-12671 [EC: 3.3.2.12]

Predicted SEED Role

"Enoyl-CoA hydratase/isomerase family protein, may be related to NAD-dependent histone deacetylation"

MetaCyc Pathways

• oleate β-oxidation (29/35 steps found)
• phenylacetate degradation I (aerobic) (9/9 steps found)
• adipate degradation (5/5 steps found)
• superpathway of phenylethylamine degradation (9/11 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• adipate biosynthesis (4/5 steps found)
• benzoyl-CoA degradation I (aerobic) (5/7 steps found)
• fatty acid β-oxidation I (generic) (5/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
• valproate β-oxidation (6/9 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• 3-phenylpropanoate degradation (5/10 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (4/9 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 3.3.2.12 or 4.2.1.17

Sequence Analysis Tools

See A0A2Z5MCI7 at UniProt or InterPro

Protein Sequence (262 amino acids)

>H281DRAFT_04594 putative oxepin-CoA hydrolase (EC 3.3.2.12) (Paraburkholderia bryophila 376MFSha3.1)
MSAELLTSRPTESESTLVLTLSNPGARNALHPDMYAAGIEALDSVERDPSIRAVVITGAD
NFFCAGGNLNRLLENRAKDPSVQAQSIDLLAEWISALRLSSKPVIAAVDGAAAGAGFSLA
LACDLIVAADDAKFVMSYARVGLTPDGGGSWFLAQALPRQLATEVLIEGKPIGAARLHEL
GVVNKLTKPGTARDAAIAWADELGKISPNSVARIKTLVCAAGTQPLSEHLVAERDNFVAS
LHHREGLEGISAFLEKRAPVYK