Protein Info for H281DRAFT_04591 in Paraburkholderia bryophila 376MFSha3.1

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 PF02771: Acyl-CoA_dh_N" amino acids 7 to 131 (125 residues), 41.5 bits, see alignment E=3.1e-14 PF02770: Acyl-CoA_dh_M" amino acids 136 to 232 (97 residues), 78.5 bits, see alignment E=6.8e-26 PF00441: Acyl-CoA_dh_1" amino acids 249 to 397 (149 residues), 131.4 bits, see alignment E=6.3e-42 PF08028: Acyl-CoA_dh_2" amino acids 266 to 371 (106 residues), 53.6 bits, see alignment E=5.7e-18

Best Hits

KEGG orthology group: K00249, acyl-CoA dehydrogenase [EC: 1.3.99.3] (inferred from 94% identity to bxe:Bxe_A3188)

Predicted SEED Role

"Putative acyl-CoA dehydrogenase oxidoreductase (EC 1.3.99.3), may be related to NAD-dependent histone acetylation" (EC 1.3.99.3)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.3

Use Curated BLAST to search for 1.3.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MBY5 at UniProt or InterPro

Protein Sequence (418 amino acids)

>H281DRAFT_04591 acyl-CoA dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
MNFDYTPKVQALREKLLAFFDAHIYPNEQAFYAEIAQNRLNGNAWQPTELIERLKQNARD
AGLWNLFLPDSVRGAGLTNLEYAPLCEIMGRVPWAPEVFNCNAPDTGNMETIERYGSEEN
KREWLEPLLQGQIRSAFLMTEPEVASSDATNIQTSIVRDGDYYVINGHKWWSSGAGDPRC
KIYIVMGKTDADAPRHQQQSMILVPADATGVTVHRPLSVFGYDDAPHGHMEITLDNVRVP
ATNMLLGEGRGFEIAQGRLGPGRIHHCMRLIGLAERALELMCKRSMQRVAFGKPVATQGV
TQERIAEARCMIEQARLLTLKTAYMMDTVGNKGARGEIAMIKVVAPNMACQVIDWAIQAH
GGGGVSDDFPLAYAYASARTLRFADGPDEVHRNAIAKLELARYIEPAAASVETPAARV