Protein Info for H281DRAFT_04586 in Paraburkholderia bryophila 376MFSha3.1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 PF02771: Acyl-CoA_dh_N" amino acids 7 to 120 (114 residues), 74.2 bits, see alignment E=1.7e-24 PF02770: Acyl-CoA_dh_M" amino acids 125 to 219 (95 residues), 75 bits, see alignment E=6.4e-25 PF00441: Acyl-CoA_dh_1" amino acids 231 to 395 (165 residues), 86.8 bits, see alignment E=2.6e-28

Best Hits

KEGG orthology group: None (inferred from 96% identity to bug:BC1001_1103)

MetaCyc: 58% identical to pimeloyl-CoA dehydrogenase large subunit (Rhodopseudomonas palustris)
Pimeloyl-CoA dehydrogenase. [EC: 1.3.1.62]

Predicted SEED Role

"Putative acyl-CoA dehydrogenase oxidoreductase (EC 1.3.99.3), may be related to NAD-dependent histone acetylation" (EC 1.3.99.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.3

Use Curated BLAST to search for 1.3.1.62 or 1.3.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MC48 at UniProt or InterPro

Protein Sequence (398 amino acids)

>H281DRAFT_04586 hypothetical protein (Paraburkholderia bryophila 376MFSha3.1)
MNLDYSPTETAFRAEIRVWLEANLPRELSEKVLNHKRLNREDFASWHKLLGTRGWSAVAW
PKEYGGPGWDATQRHIWDEECARVGAPTVLPFGVSMVAPVLMKYGSEAQKRYYLPRILDG
TDWWCQGYSEPGSGSDLASLRTRAERVGDHYVVNGQKTWTTLGQHADMMFCLVRTDSGAK
KQEGISFLLIDMKTPGITVRPIITLDEDHEVNEVFFEDVKVPVENLVGGENRGWTYAKYL
LGHERTGIARVGQSKRELVFLKRLALDTNKNGKPLLRDPVFAAKVANLEIELMALEVTVQ
RVVANEAGGRGPGPEASMLKIKGTEVQQALTELMFEAVGPAAAPFDVPFLEGEREHSIAG
DDDAAPLAAYYFNFRKTSIYGGSNEIQKNIIAQMILGL