Protein Info for H281DRAFT_04561 in Paraburkholderia bryophila 376MFSha3.1
Annotation: SSU ribosomal protein S15P
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 98% identical to RS15_PARXL: 30S ribosomal protein S15 (rpsO) from Paraburkholderia xenovorans (strain LB400)
KEGG orthology group: K02956, small subunit ribosomal protein S15 (inferred from 98% identity to bpy:Bphyt_1338)MetaCyc: 66% identical to 30S ribosomal subunit protein S15 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"SSU ribosomal protein S15p (S13e)" in subsystem Ribosome SSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A2Z5MCM4 at UniProt or InterPro
Protein Sequence (90 amino acids)
>H281DRAFT_04561 SSU ribosomal protein S15P (Paraburkholderia bryophila 376MFSha3.1) MSAVDTSKKSEVVAQFARAANDTGSPEVQVALLTTRINELTVHFKAHAKDHHSRRGLLRM VSRRRKLLDYLKGKDADRYRALIEKLGLRK