Protein Info for H281DRAFT_04554 in Paraburkholderia bryophila 376MFSha3.1

Annotation: phosphatidylserine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00164: phosphatidylserine decarboxylase homolog
  • amino acids 7 to 210 (204 residues), 227.1 bits, E=7.2e-72
• PF02666: PS_Dcarbxylase
  • amino acids 43 to 209 (167 residues), 157.5 bits, E=1.7e-50

Best Hits

Swiss-Prot: 96% identical to PSD_PARPJ: Phosphatidylserine decarboxylase proenzyme (psd) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 98% identity to bgf:BC1003_2332)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.65

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

See A0A2Z5MEI0 at UniProt or InterPro

Protein Sequence (212 amino acids)

>H281DRAFT_04554 phosphatidylserine decarboxylase (Paraburkholderia bryophila 376MFSha3.1)
MNYPHPIIAREGWPFIAIAAVVALLVHAFAGFGFAWLFWLILIFIVQFFRDPARPIPTQA
NAVLCPADGRIVAVETAHDPYANREALKISVFMNVFNVHSQRSPVDGAISKVEYFPGAYL
NAAVEKASLENERNAIVIEMAGGQTVTSVQIAGLIARRILCYVRAGEPLSRGQRYGFIRF
GSRVDVYLPVGSRPRVSIGEKVSASSTILAEL