Protein Info for H281DRAFT_04553 in Paraburkholderia bryophila 376MFSha3.1

Annotation: ketol-acid reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02826: 2-Hacid_dh_C
  • amino acids 12 to 84 (73 residues), 27.3 bits, E=5.6e-10
• PF07991: IlvN
  • amino acids 14 to 177 (164 residues), 241 bits, E=1.2e-75
• TIGR00465: ketol-acid reductoisomerase
  • amino acids 14 to 326 (313 residues), 438.8 bits, E=4.6e-136
• PF03446: NAD_binding_2
  • amino acids 18 to 103 (86 residues), 26.2 bits, E=1.8e-09
• PF03807: F420_oxidored
  • amino acids 19 to 92 (74 residues), 30 bits, E=1.7e-10
• PF01450: IlvC
  • amino acids 183 to 326 (144 residues), 216.4 bits, E=5e-68

Best Hits

Swiss-Prot: 99% identical to ILVC_PARXL: Ketol-acid reductoisomerase (NADP(+)) (ilvC) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K00053, ketol-acid reductoisomerase [EC: 1.1.1.86] (inferred from 99% identity to bge:BC1002_0943)

MetaCyc: 91% identical to acetohydroxyacid isomeroreductase (Cupriavidus necator H16)
Ketol-acid reductoisomerase. [EC: 1.1.1.86]; 1.1.1.86 [EC: 1.1.1.86]

Predicted SEED Role

"Ketol-acid reductoisomerase (EC 1.1.1.86)" in subsystem Branched-Chain Amino Acid Biosynthesis or Coenzyme A Biosynthesis (EC 1.1.1.86)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• phosphopantothenate biosynthesis I (4/4 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (8/10 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• phosphopantothenate biosynthesis III (archaea) (2/4 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.86

Sequence Analysis Tools

See A0A2Z5ME40 at UniProt or InterPro

Protein Sequence (338 amino acids)

>H281DRAFT_04553 ketol-acid reductoisomerase (Paraburkholderia bryophila 376MFSha3.1)
MKVFYDKDADLSLIKGKQVTIIGYGSQGHAHALNLKESGVNITVGLRKGGASWSKAENAG
LQVKEVAEAVKGADVVMMLLPDEQIAEVYAKEVHGNAKQGAALAFAHGFNVHYGQVIPRA
DLDVIMIAPKAPGHTVRGTYTQGGGVPHLIAVAQDKSGAARDIALSYAAANGGGRAGIIE
TNFREETETDLFGEQAVLCGGTVDLIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYE
GGIANMNYSISNNAEYGEYVTGPRIVTAETKKAMKAVLTDIQTGEYAKSFIIENKAGAPT
LQSRRRLTAEHQIEQVGSKLRAMMPWIAKNKLVDQSKN