Protein Info for H281DRAFT_04516 in Paraburkholderia bryophila 376MFSha3.1

Annotation: septum formation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF02545: Maf" amino acids 12 to 204 (193 residues), 187.6 bits, see alignment E=9.7e-60 TIGR00172: septum formation protein Maf" amino acids 12 to 203 (192 residues), 158 bits, see alignment E=9.6e-51

Best Hits

Swiss-Prot: 90% identical to NTPPA_PARXL: dTTP/UTP pyrophosphatase (Bxeno_A1178) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K06287, septum formation protein (inferred from 92% identity to bug:BC1001_1034)

Predicted SEED Role

"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MCA7 at UniProt or InterPro

Protein Sequence (209 amino acids)

>H281DRAFT_04516 septum formation protein (Paraburkholderia bryophila 376MFSha3.1)
MPTSTASLHPFVYLASQSPRRQELLQQIGVRFELLLPRPDEDAEALEAELPGERAHDYVQ
RVCVAKARAAHARLVAGNHAARPVLVADTTVTIDDAILGKPLDANDAEAMLARLSGRDHE
VLTAVAVVDAYGELLPAALSTSTVRFAALHRDAIRRYVASGEPFGKAGAYGVQGRAAEFI
EHIDGSYSGIMGLPLFETAALLRAARIDF