Protein Info for H281DRAFT_04495 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 3-oxoacid CoA-transferase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02429: 3-oxoacid CoA-transferase, A subunit
  • amino acids 1 to 216 (216 residues), 274 bits, E=3.8e-86
• PF01144: CoA_trans
  • amino acids 8 to 217 (210 residues), 267.6 bits, E=3.6e-84

Best Hits

Swiss-Prot: 75% identical to SCOA_XANCB: Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A (lpsI) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K01028, 3-oxoacid CoA-transferase subunit A [EC: 2.8.3.5] (inferred from 97% identity to bpy:Bphyt_2761)

MetaCyc: 60% identical to succinyl-CoA-transferase subunit A (Helicobacter pylori 26695)
3-oxoacid CoA-transferase. [EC: 2.8.3.5]

Predicted SEED Role

"Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (EC 2.8.3.5)" in subsystem Catechol branch of beta-ketoadipate pathway or Leucine Degradation and HMG-CoA Metabolism or Protocatechuate branch of beta-ketoadipate pathway or Serine-glyoxylate cycle (EC 2.8.3.5)

MetaCyc Pathways

• ketolysis (3/3 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Synthesis and degradation of ketone bodies
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.5

Use Curated BLAST to search for 2.8.3.5

Sequence Analysis Tools

See A0A2Z5MDR5 at UniProt or InterPro

Protein Sequence (234 amino acids)

>H281DRAFT_04495 3-oxoacid CoA-transferase subunit A (Paraburkholderia bryophila 376MFSha3.1)
MNKVYPGAAEALKDIVKDGQTFAVGGFGLCGIPEALIAALRDTKVQNITCISNNAGVDGF
GLGLLLETRQIKKMISSYVGENKEFERQYLAGELELEFTPQGTLAEKLRAGGSGIPAFFT
NTGYGTLIAEGKETRQFGENHYVLEHSLTADVALVKAWKADKSGNLIYRRTARNFNPMCA
MAGKITVAEVEEIVEVGELDPDAIHTPGIFVQRIVLNAHPEKRIEQRVVRAKGD