Protein Info for H281DRAFT_04475 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Uncharacterized membrane protein YccC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 736 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 123 (18 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details amino acids 422 to 439 (18 residues), see Phobius details amino acids 447 to 469 (23 residues), see Phobius details amino acids 475 to 492 (18 residues), see Phobius details amino acids 498 to 515 (18 residues), see Phobius details amino acids 527 to 548 (22 residues), see Phobius details PF04632: FUSC" amino acids 31 to 717 (687 residues), 735.6 bits, see alignment E=6.4e-225 PF13515: FUSC_2" amino acids 45 to 172 (128 residues), 47.5 bits, see alignment E=2e-16

Best Hits

KEGG orthology group: None (inferred from 91% identity to bug:BC1001_2438)

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (736 amino acids)

>H281DRAFT_04475 Uncharacterized membrane protein YccC (Paraburkholderia bryophila 376MFSha3.1)
MSAPSSCAPRPSSFAVWYSAAAEWARTDGLTWIYLFKALAACFLALGIAMKLDLPQPRTA
MTTVFIVMQPQSGMVFAKSFYRICGTLVGLVVTLALLGLFAQQPEMFIVATAIWVGICTA
GAARNRNFRSYGFVLAGYTAALIGIPASQHPDGAFLSALTRVAEVVLGIVCAGAVSGLVF
PQFTGLQMRGTVRARFSAFVEYVSTSLAGRNDRAQIEATNARFVADIVGFEAARSVAVFE
GPDSRMRGGRLARLNSEFMTASTRFHALHQLMNRLRDAGTHGAAIAIDALEPYFKEIAPL
LAKSGEPVLSAADAAHAAAQLDAYKAELPRRVRATRAALEAHPNAPLLDFDTGAELLYRF
IDDLHAYAATYASLAVDTHERERWVERYQPKTNAIAAGVAGLRAALVMIVLGAFWIATAW
PSGLTLTLNAATVCALASSSPNPKRTVFQMAGGTLVASVMGMLAVYGVFPRIDGFPLLCA
ALAPFLLFGVFMTTRPALAGYGVGYCIFFCFLAGPDNVMHYDPSAFINDAIALVLSMLVS
SVAFAVLLPPSTPWLRNRLLVDLRRQVAVASRARLGRVRSRFESGARDLMFQINALAQDD
ASAKRDTLRWLFSVLEVGNAVIDLRREVAMLPADPRYAKTMPWRVSLHAVCDALSALFER
PRAERFERALAATANSIGAVQLLLAEFTPPREERHQLQRILSQLHFIRTALLDPQSPLEP
LMSARADASEGVPHAA