Protein Info for H281DRAFT_04473 in Paraburkholderia bryophila 376MFSha3.1

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 transmembrane" amino acids 64 to 85 (22 residues), see Phobius details amino acids 245 to 270 (26 residues), see Phobius details PF12729: 4HB_MCP_1" amino acids 59 to 194 (136 residues), 38.9 bits, see alignment E=6.7e-14 PF00015: MCPsignal" amino acids 387 to 541 (155 residues), 185.3 bits, see alignment E=8.7e-59

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 94% identity to bgf:BC1003_2410)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MC79 at UniProt or InterPro

Protein Sequence (576 amino acids)

>H281DRAFT_04473 methyl-accepting chemotaxis protein (Paraburkholderia bryophila 376MFSha3.1)
MPEQTFAAVLNVGTGNMKAVSLGSRTGAGFVPDGKAAASPSRGKGGNSGRSRAVSLKGLS
VKTMLRLAFAVLLIGTLAIGVFSLTQISRLNASAQSIYDQGHVASRAAEEARGHMLRASR
AQKMLLTATTAKERDELGTDIDKGLNGLSSELSTLQQYVDKSDAKAVEHQKKFSAAVTVW
SAHLRDFVTLVKAQPLDLSQMNWQVGTQDVSLLVETGKLEKLVDEMVTERGTAAKATIDA
SRFIYQSSFVMLAVMTIGLIVLAAGISEWVVRRLARQLGGEPAYAKEIASRIAAGDLSNH
ITLGRKDKSSVLYALSDMQSGLATTVSDIASSADAIATASGEISMGNLDLSQRTEQQAMA
LERTATSMEQLTSTVRQNADNAKQASTLANNASEIAEKGGEVVSRVVATMNEINDSARSI
GDIIGVIEGIAFQTNILALNAAVEAARAGEEGRGFSVVAAEVRNLAQRSAAAAKEIKGLI
STSVERVSNGSTLAQDAGQTMDEVVKAVKRVTDIMGEISAASSEQSAGIEEINLAVAQMD
SGTQQNAALVEQATAAARSLDDQAHGLKQMVGKFRL