Protein Info for H281DRAFT_04458 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 661 TIGR04377: 3,5/4-trihydroxycyclohexa-1,2-dione hydrolase" amino acids 26 to 637 (612 residues), 914.5 bits, see alignment E=1.8e-279 PF02776: TPP_enzyme_N" amino acids 28 to 155 (128 residues), 68.4 bits, see alignment E=7.3e-23 PF00205: TPP_enzyme_M" amino acids 242 to 374 (133 residues), 118.3 bits, see alignment E=3.2e-38 PF02775: TPP_enzyme_C" amino acids 442 to 596 (155 residues), 117.3 bits, see alignment E=8.2e-38

Best Hits

KEGG orthology group: K03336, 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [EC: 3.7.1.-] (inferred from 90% identity to bug:BC1001_2456)

Predicted SEED Role

"Epi-inositol hydrolase (EC 3.7.1.-)" in subsystem Inositol catabolism (EC 3.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.-

Use Curated BLAST to search for 3.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (661 amino acids)

>H281DRAFT_04458 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase (Paraburkholderia bryophila 376MFSha3.1)
MNQRELQHGHDEAASAGAVVSGTTIRLTTAQALVRYLAAQRVATEDGSGTEPLFGGVFAI
FGHGNVAGMGEALYQHRDELPTLRAHNEQAMAHSAIAYAKAHFRRRMMAVTTSIGPGATN
LLTAAALAHVNRLPVLLLPGDIFVSRAPDPVLQQVEDFHDGGVSANDAFKPVSRYFDRIM
HPAQLLSALPRALRVLTDAASCGPVTLALPQDVQAQAWDFPADFFAPRIVTFYAPAPRVD
EIDAAVARLQRAKRPLIVAGGGVLYGRATDALQRFAAAHGIPVAETQAGKSSLAWDDPLN
AGSLGVTGSPAANALARDADCVLALGTRLQDFTTGSNTLFTQADVIGINANAFDALKHRA
QVVEADARLALDALAERLQDWQADRAWTSRAHELAASWRDTVHTLTHAPQRESVLPYEGD
VIGAVQRSSTDSPANDIVVCAAGTLPGELHKLWRAGTPGAYHVEYGYSCMGYEIAGGLGV
KLARPEREVIVMVGDGSYLMMNSEIATSVMLGAKLIVVVLDNRGYGCINRLQQACGGAPF
NNLLEDSMQGPLGAPQIDFAAHARALGARAEHAANVAELEAALQRARSADRTYVISIDTD
PARTTSDGGWWWEVAVPEVSPRASVREARANYDAQISARGKPPASAENSGNGSNSNDQAN
D