Protein Info for H281DRAFT_04452 in Paraburkholderia bryophila 376MFSha3.1

Annotation: amino acid/amide ABC transporter membrane protein 2, HAAT family (TC 3.A.1.4.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 28 to 45 (18 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 232 to 255 (24 residues), see Phobius details amino acids 268 to 297 (30 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 344 to 368 (25 residues), see Phobius details amino acids 388 to 415 (28 residues), see Phobius details PF02653: BPD_transp_2" amino acids 53 to 316 (264 residues), 86.2 bits, see alignment E=1.1e-28

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein K01998, branched-chain amino acid transport system permease protein (inferred from 79% identity to bug:BC1001_2462)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>H281DRAFT_04452 amino acid/amide ABC transporter membrane protein 2, HAAT family (TC 3.A.1.4.-) (Paraburkholderia bryophila 376MFSha3.1)
MRELLKPEPAQASPVAGTQRSHAMWRRLAPWLALIVLLTAPPLIWRQSWLLVYLAQTATM
IVFALSYNLLLGETGLLSFGHAAYSGLGALIAAQVFNRIGAPLALLPLVGGAGAASCGAL
LGFISTRRAGTAFAMITLGIGELVAAAAWTLPDWFGGEAGVAIDRASGPMLGAFTFGPAR
EAYTLIALWCLLASAAMFALSRTSFMRLANAVRDNPARAAAIGCYPRRVRYGVVVMSAFF
AGIAGTLALINVELVSTDSVSMVRSGSVLIATVIGGTGVFFGPVAGAVVLTFFSVAVASV
TRAWLFYLGLFFIVIVVAAPDGLAGFIQRHTARLARDGWRTCRAVYVCGTAAILLWTVAT
VLAVQWAYAVQFGVEEGAALRVGGQSSWLSFVVASPLRLGLTIFVLAALGALAALSASRA
QTRLAAHARTMQNAGGPQ