Protein Info for H281DRAFT_04428 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Uncharacterized protein YjbI, contains pentapeptide repeats

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00805: Pentapeptide" amino acids 48 to 78 (31 residues), 23.2 bits, see alignment 6e-09 amino acids 76 to 113 (38 residues), 21.6 bits, see alignment 1.9e-08 amino acids 101 to 139 (39 residues), 35.1 bits, see alignment 1.2e-12 amino acids 153 to 190 (38 residues), 28.5 bits, see alignment 1.3e-10 amino acids 176 to 215 (40 residues), 41.3 bits, see alignment 1.3e-14 amino acids 193 to 221 (29 residues), 29 bits, see alignment (E = 9.3e-11) PF13599: Pentapeptide_4" amino acids 48 to 128 (81 residues), 41.3 bits, see alignment E=2.2e-14 amino acids 62 to 148 (87 residues), 50.1 bits, see alignment E=4e-17 amino acids 126 to 203 (78 residues), 43.3 bits, see alignment E=5.3e-15 amino acids 161 to 226 (66 residues), 31.3 bits, see alignment E=3e-11 PF13576: Pentapeptide_3" amino acids 154 to 196 (43 residues), 33 bits, see alignment 8.3e-12

Best Hits

KEGG orthology group: None (inferred from 85% identity to bpy:Bphyt_2842)

Predicted SEED Role

"FIG00455083: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>H281DRAFT_04428 Uncharacterized protein YjbI, contains pentapeptide repeats (Paraburkholderia bryophila 376MFSha3.1)
MSLDSTAPAPGAPVHEVADATLTRADVEQLIAASAVANRQASAAPLVFNDCDLEGADLSR
LDLRGAQFHRCALAEASFFGAALAQTRWVRCRARQADFASADLVDAAFQSSDLNNTDWRR
AKLASASFSSCKLTGANFEACTALGLSFVETLLVGAHLRGLSFRKATLHQLDFSDADLAG
VDFREAIFDGGSLKDAHLKGARFDGADLREADLSGVRLVDAALFKGATISHLQAAVLITE
LGLRVM