Protein Info for H281DRAFT_04404 in Paraburkholderia bryophila 376MFSha3.1

Annotation: GreA/GreB family elongation factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF03449: GreA_GreB_N" amino acids 4 to 74 (71 residues), 106.6 bits, see alignment E=6.1e-35 TIGR01462: transcription elongation factor GreA" amino acids 5 to 155 (151 residues), 191.5 bits, see alignment E=4.5e-61 PF01272: GreA_GreB" amino acids 83 to 157 (75 residues), 101.6 bits, see alignment E=1.8e-33

Best Hits

Swiss-Prot: 79% identical to GREA_RALSO: Transcription elongation factor GreA (greA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03624, transcription elongation factor GreA (inferred from 95% identity to bpy:Bphyt_2866)

Predicted SEED Role

"Transcription elongation factor GreA" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MCZ8 at UniProt or InterPro

Protein Sequence (158 amino acids)

>H281DRAFT_04404 GreA/GreB family elongation factor (Paraburkholderia bryophila 376MFSha3.1)
MSTIPLTKRGADMLRDELQRLKSVERPAVINSISEARAQGDLSENAEYDAAKEKQGFIEG
RIAEIESKLAGAQVIDPSKVDADGRVVFGATVELEDLASGASVKYQIVGDDEADIDHGLI
SISSPIARALIGKSEGDVASVQAPGGVREYEIIAVSYV