Protein Info for H281DRAFT_04367 in Paraburkholderia bryophila 376MFSha3.1

Annotation: beta-N-acetylhexosaminidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF00933: Glyco_hydro_3" amino acids 11 to 302 (292 residues), 238.7 bits, see alignment E=5.8e-75

Best Hits

Swiss-Prot: 59% identical to NAGZ_BORA1: Beta-hexosaminidase (nagZ) from Bordetella avium (strain 197N)

KEGG orthology group: K01207, beta-N-acetylhexosaminidase [EC: 3.2.1.52] (inferred from 94% identity to bgf:BC1003_2502)

MetaCyc: 51% identical to beta-N-acetylhexosaminidase (Pseudomonas aeruginosa PAO1)
Beta-N-acetylhexosaminidase. [EC: 3.2.1.52]

Predicted SEED Role

"Beta N-acetyl-glucosaminidase (EC 3.2.1.52)" (EC 3.2.1.52)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MEX2 at UniProt or InterPro

Protein Sequence (342 amino acids)

>H281DRAFT_04367 beta-N-acetylhexosaminidase (Paraburkholderia bryophila 376MFSha3.1)
MKTNPGPVMLDVVGKTLNDDDKRRLAHPMTGGVILFARHYESRAQLIALTDSIRAIREDL
LIAVDHEGGRVQRFRTDGFTVLPAMGKLGALWDSDVMHATKVTTAVGYILASELRACGID
MSFTPVLDLNYGQSQVIGDRAFHSDPRVVAMLAKNLNHGLALAGMSNCGKHFPGHGFAHA
DSHVAMPVDERSLDEILRDDVAPYDWLGLSLGSVIPAHVVYPQVDSRPAGFSRIWLQDIL
RGKLRFEGAIFSDDLSMEAARQGGTLTEGATAALQAGCDMALICNQPEKAEQVLDELRFT
PSKESQQRLKRMRPRDKALKWSKLVAEPRYLQAQALLRSVFA