Protein Info for H281DRAFT_04364 in Paraburkholderia bryophila 376MFSha3.1

Annotation: DNA replication and repair protein RecO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF11967: RecO_N" amino acids 74 to 146 (73 residues), 74.3 bits, see alignment E=6.5e-25 TIGR00613: DNA repair protein RecO" amino acids 76 to 222 (147 residues), 85 bits, see alignment E=2.7e-28 PF02565: RecO_C" amino acids 152 to 293 (142 residues), 55.4 bits, see alignment E=6.7e-19

Best Hits

Swiss-Prot: 86% identical to RECO_PARXL: DNA repair protein RecO (recO) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K03584, DNA repair protein RecO (recombination protein O) (inferred from 91% identity to bgf:BC1003_2505)

Predicted SEED Role

"DNA recombination and repair protein RecO" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MCM7 at UniProt or InterPro

Protein Sequence (305 amino acids)

>H281DRAFT_04364 DNA replication and repair protein RecO (Paraburkholderia bryophila 376MFSha3.1)
MGTNDAWVTLNSDTDPDDSGPAAPSREPSKPARASRKSSTKSTSDTGPDDAPRKAPARRS
SRGSASASEYRIAEQPAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVL
QTFQPLALSWSGRGEVRTLTGAEWVGGMLPLTGDALLCGFYVNELLVKFCAREDPHPQLF
HHYVVTMTRLAHDEPPVQVLRSFERVLLRETGYAMALDRTVARKAVEAGSRYVFDPERGV
REASDDLPSQWPVIAGQTLLDMEKDDYHRAQTVAQSKTLMRFLLNTYLGGTPLATRQILI
DLQNL