Protein Info for H281DRAFT_04309 in Paraburkholderia bryophila 376MFSha3.1

Annotation: transcriptional regulator, ArsR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF12840: HTH_20" amino acids 22 to 71 (50 residues), 29.4 bits, see alignment 9.2e-11 PF01022: HTH_5" amino acids 24 to 69 (46 residues), 25 bits, see alignment 2e-09

Best Hits

KEGG orthology group: None (inferred from 93% identity to bug:BC1001_2588)

Predicted SEED Role

"Predicted transcriptional regulators"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MF83 at UniProt or InterPro

Protein Sequence (237 amino acids)

>H281DRAFT_04309 transcriptional regulator, ArsR family (Paraburkholderia bryophila 376MFSha3.1)
MPASLADEQNHFPGLSRIGALLADPGRAAMLWALMDGSARPAGELTMIAGLSPSAASAHL
ARLTEGGLLALEVRGRHRYFRIASADIAASIEALANVAQVSAPQRPVPRPVRTVPTDMRY
ARTCYDHMAGELSVRVFERLVGRGLLALNGASLEATPEGAARFSDWGIDLSAQRSRRRRF
ACTCPDWSERRPHLGGALGAALLDSWAAHGWVERTERPRILRITPAGHRHFDAFLAE