Protein Info for H281DRAFT_04302 in Paraburkholderia bryophila 376MFSha3.1

Annotation: molybdopterin adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00177: molybdenum cofactor synthesis domain
  • amino acids 29 to 173 (145 residues), 116.9 bits, E=3.6e-38
• PF00994: MoCF_biosynth
  • amino acids 31 to 172 (142 residues), 86.1 bits, E=1e-28

Best Hits

Swiss-Prot: 73% identical to MOG_SHIFL: Molybdopterin adenylyltransferase (mog) from Shigella flexneri

KEGG orthology group: K03831, molybdopterin adenylyltransferase (inferred from 90% identity to bug:BC1001_2596)

MetaCyc: 73% identical to molybdopterin adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-8344 [EC: 2.7.7.75]

Predicted SEED Role

"Molybdopterin biosynthesis molybdochelatase MogA"

MetaCyc Pathways

• molybdenum cofactor biosynthesis (2/3 steps found)
• bis(tungstenpterin) cofactor biosynthesis (1/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.75

Protein Sequence (227 amino acids)

>H281DRAFT_04302 molybdopterin adenylyltransferase (Paraburkholderia bryophila 376MFSha3.1)
MPATPWKTTMTTATPDTKLKRNHPDEILIGLVSISDRASTGVYEDKGIPALQEWLGAALS
SPWQVVTRLIQDDAPTISATLTELVDEVGCDLVLTTGGTGPSRRDVTPEATLAVATKEMP
GFGEQMRQISLNFVPTAILSRQVAVIRETADHAALIVNLPGQPKSIKETLEGLRDADVET
GGTVKVPGIFAAVPYCIDLIGGPYVETNAEVVKAFRPKSAVRAPRQA