Protein Info for H281DRAFT_04290 in Paraburkholderia bryophila 376MFSha3.1

Annotation: TM2 domain-containing membrane protein YozV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 16 to 33 (18 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 68 to 92 (25 residues), see Phobius details amino acids 112 to 138 (27 residues), see Phobius details PF05154: TM2" amino acids 12 to 56 (45 residues), 36.3 bits, see alignment E=2.7e-13

Best Hits

KEGG orthology group: None (inferred from 90% identity to bug:BC1001_2609)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>H281DRAFT_04290 TM2 domain-containing membrane protein YozV (Paraburkholderia bryophila 376MFSha3.1)
MSKPVPTSTYFRSKTITAALAFFLGTLGAHRFYLYGPRDLFGWAHLIGTLIGIPGAMLLA
ASERTSMLGWVLAFPGAVSLLAAFLAAIVYGLRPDEKWDRQFNAHTQRTSRSGWTVIFVV
IFSLLIGAFLLMTGLAISFQTYFEGQVQAAKALSQ