Protein Info for H281DRAFT_04287 in Paraburkholderia bryophila 376MFSha3.1

Annotation: D-amino-acid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF00070: Pyr_redox" amino acids 2 to 34 (33 residues), 26.5 bits, see alignment (E = 3e-09) PF01266: DAO" amino acids 2 to 396 (395 residues), 278.5 bits, see alignment E=4.6e-86 PF02558: ApbA" amino acids 3 to 33 (31 residues), 23 bits, see alignment (E = 2.1e-08) PF00890: FAD_binding_2" amino acids 3 to 250 (248 residues), 22 bits, see alignment E=3.5e-08 PF13450: NAD_binding_8" amino acids 5 to 38 (34 residues), 27 bits, see alignment 1.8e-09

Best Hits

Swiss-Prot: 96% identical to DADA_PARPJ: D-amino acid dehydrogenase (dadA) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K00285, D-amino-acid dehydrogenase [EC: 1.4.99.1] (inferred from 97% identity to bug:BC1001_2612)

MetaCyc: 74% identical to D-amino acid dehydrogenase (Escherichia coli K-12 substr. MG1655)
RXN-11193 [EC: 1.4.5.1]; 1.4.5.- [EC: 1.4.5.1]

Predicted SEED Role

"D-amino acid dehydrogenase small subunit (EC 1.4.99.1)" in subsystem Pyruvate Alanine Serine Interconversions or Respiratory dehydrogenases 1 (EC 1.4.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.99.1

Use Curated BLAST to search for 1.4.5.1 or 1.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MF40 at UniProt or InterPro

Protein Sequence (438 amino acids)

>H281DRAFT_04287 D-amino-acid dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
MRVVVLGSGVVGVTSAYYLARAGHEVTVIDREAGPALETSFANAGQISPGYASPWAAPGV
PLKAVKWMFQKHAPLAIRLDGTQFQLQWMWQMLQNCTESRYAVNKGRMVRLAEYSRDCLQ
ALRAETGIQYEGRTGGTLQVFRTQQQFDGAAKDIAVLREANVPYELLSAAELAQAEPALA
AVSHKLTGGLRLPGDETGDCQMFTTRLAALAEQLGVKFRYNTPIDALAMAGDRIAGVQCG
NELVRADSFVVALGSYSTKFLSGLVKIPVYPLKGYSITAPIVNEAAAPVSTVLDETYKIA
ITRFDNRIRVGGMAEIVGFDKSLRQARRETLELCVNDLFPGGGDTSKASFWTGLRPMTPD
GTPIVGRTPVANLFLNTGHGTLGWTMSCGSGQLLADVISGKQPAIKADDLSVHRYLGDTG
SAHRPAYARSVTSRTREI