Protein Info for H281DRAFT_04275 in Paraburkholderia bryophila 376MFSha3.1

Annotation: gluconate kinase, SKI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF13671: AAA_33" amino acids 3 to 135 (133 residues), 34.8 bits, see alignment E=1.9e-12 TIGR01313: carbohydrate kinase, thermoresistant glucokinase family" amino acids 4 to 162 (159 residues), 191.5 bits, see alignment E=4.3e-61 PF01202: SKI" amino acids 10 to 161 (152 residues), 46.8 bits, see alignment E=3.5e-16

Best Hits

Swiss-Prot: 44% identical to GNTK_ARATH: Gluconokinase (At2g16790) from Arabidopsis thaliana

KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 94% identity to bxe:Bxe_A0592)

MetaCyc: 44% identical to D-gluconate kinase, thermostable (Escherichia coli K-12 substr. MG1655)
Gluconokinase. [EC: 2.7.1.12]

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>H281DRAFT_04275 gluconate kinase, SKI family (Paraburkholderia bryophila 376MFSha3.1)
MILIAMGVSGAGKTRIGEMLAERLHCAFTDGDAFHSAANKEKMHHGIPLTDEDRWPWLKT
IRAAIEEKQKAGETAVFTCSSLKRSYRDILRDGDKDVCFVYLKGSREVLEQRLTTRTGHF
FDPSLLQSQLDTLEEPGPDEAVTVSIELSPEQIVDEVLKQVQQR