Protein Info for H281DRAFT_04267 in Paraburkholderia bryophila 376MFSha3.1

Annotation: L-glutamate ABC transporter ATP-binding protein /L-aspartate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 18 to 165 (148 residues), 124.2 bits, E=9.1e-40

Best Hits

Swiss-Prot: 82% identical to GLTL_ECO57: Glutamate/aspartate import ATP-binding protein GltL (gltL) from Escherichia coli O157:H7

KEGG orthology group: K10004, glutamate/aspartate transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 97% identity to bph:Bphy_2570)

MetaCyc: 82% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport ATP-binding protein GltL (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

See A0A2Z5ME01 at UniProt or InterPro

Protein Sequence (241 amino acids)

>H281DRAFT_04267 L-glutamate ABC transporter ATP-binding protein /L-aspartate ABC transporter ATP-binding protein (Paraburkholderia bryophila 376MFSha3.1)
MISIKNVSKWYGQFQVLTDCTTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPFQKGEIVI
NGQSLTDKKTNLSKLRSKVGMVFQHFELFPHLSIVQNLTLAQIKVLGRSKDEASAKGLKL
LDRVGLRAHADKFPGQLSGGQQQRVAIARALSMDPIAMLFDEPTSALDPEMINEVLDVMV
ELAQEGMTMMCVTHEMGFAKKVAHRVIFMDKGLIVEDDRKEDFFANPKSDRAKDFLAKIL
H