Protein Info for H281DRAFT_04258 in Paraburkholderia bryophila 376MFSha3.1

Annotation: tyrosyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 TIGR00234: tyrosine--tRNA ligase" amino acids 23 to 413 (391 residues), 387.9 bits, see alignment E=3e-120 PF00579: tRNA-synt_1b" amino acids 52 to 334 (283 residues), 263.9 bits, see alignment E=2.8e-82 PF13275: S4_2" amino acids 349 to 402 (54 residues), 27 bits, see alignment 5e-10 PF01479: S4" amino acids 359 to 399 (41 residues), 25.8 bits, see alignment 1e-09

Best Hits

Swiss-Prot: 94% identical to SYY_BURL3: Tyrosine--tRNA ligase (tyrS) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K01866, tyrosyl-tRNA synthetase [EC: 6.1.1.1] (inferred from 97% identity to bgf:BC1003_2931)

Predicted SEED Role

"Tyrosyl-tRNA synthetase (EC 6.1.1.1)" (EC 6.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MF29 at UniProt or InterPro

Protein Sequence (416 amino acids)

>H281DRAFT_04258 tyrosyl-tRNA synthetase (Paraburkholderia bryophila 376MFSha3.1)
MSTESTKPNAAPAFPITDEVRHALAVTKRGVDELLIEEEFAQKLAKSAATGTPLRIKLGL
DPTAPDIHIGHTVVLNKMRQLQDLGHTVIFLIGDFTSLIGDPSGRNATRPPLTREQIESN
AKTYFEQAALVLDREKTEIRYNSEWSMPLGADGMIKLASRYTVARILEREDFTKRFQSGV
PISIHEFLYPLMQGYDSVALNADLELGGTDQKFNLLVGRELQKQYGQEQQCILTMPLLEG
LDGVEKMSKSKNNYIGISEKPTEMFGKLMSISDVLMWRYFELLSFRPMDEIAGFKKEIEA
GRNPRDFKVMLGQEIVARFHSQADAQRALEDFNHRAKGGVPDDIPAVTLAGAPLAIGQLL
KQANLVPSTSEALRNIEQGGVKIDGATVSDKGLKVESGEYVVQVGKRRFARVTLTA