Protein Info for H281DRAFT_04253 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Holliday junction endonuclease RuvC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02075: RuvC
  • amino acids 3 to 149 (147 residues), 170.7 bits, E=9.6e-55
• TIGR00228: crossover junction endodeoxyribonuclease RuvC
  • amino acids 3 to 151 (149 residues), 177.4 bits, E=9.7e-57

Best Hits

Swiss-Prot: 99% identical to RUVC_PARXL: Crossover junction endodeoxyribonuclease RuvC (ruvC) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K01159, crossover junction endodeoxyribonuclease RuvC [EC: 3.1.22.4] (inferred from 97% identity to bgf:BC1003_2926)

MetaCyc: 56% identical to crossover junction endodeoxyribonuclease RuvC (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Crossover junction endodeoxyribonuclease RuvC (EC 3.1.22.4)" in subsystem DNA-replication or RuvABC plus a hypothetical (EC 3.1.22.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10 or 3.1.22.4

Sequence Analysis Tools

See A0A2Z5ME59 at UniProt or InterPro

Protein Sequence (180 amino acids)

>H281DRAFT_04253 Holliday junction endonuclease RuvC (Paraburkholderia bryophila 376MFSha3.1)
MRILGIDPGLRVTGFGVIDQSGHTLSYVASGIIKTADADLPSRLGTIFEGISTLIRQHSP
DQSAIEKVFVNVNPQSTLLLGQARGAAICGLVAGGVPVAEYTALQLKQAVVGYGRATKEQ
MQQMVVRLLNLSGVPSTDAADALGMAICHAHGGTTLSTLGGIAPSLAKKGLRVRRGRLVG