Protein Info for H281DRAFT_04250 in Paraburkholderia bryophila 376MFSha3.1

Annotation: DNA-binding protein Fis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 77 PF02954: HTH_8" amino acids 37 to 73 (37 residues), 56.5 bits, see alignment E=9.4e-20

Best Hits

Swiss-Prot: 70% identical to FISL_RALSO: Putative Fis-like DNA-binding protein (RSc0505) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03557, Fis family transcriptional regulator, factor for inversion stimulation protein (inferred from 96% identity to bph:Bphy_2552)

Predicted SEED Role

"DNA-binding protein Fis" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MG51 at UniProt or InterPro

Protein Sequence (77 amino acids)

>H281DRAFT_04250 DNA-binding protein Fis (Paraburkholderia bryophila 376MFSha3.1)
MSKNNIEQSVRDSLGVYFQDLDGSNPHDVYDMVISCVEKPLLEVVLEQAGGNQSLAAEYL
GINRNTLRKKLQQHGLL