Protein Info for H281DRAFT_04217 in Paraburkholderia bryophila 376MFSha3.1

Annotation: putative copper resistance protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details PF05425: CopD" amino acids 197 to 298 (102 residues), 67.2 bits, see alignment E=7.6e-23

Best Hits

KEGG orthology group: K07245, putative copper resistance protein D (inferred from 90% identity to bug:BC1001_2953)

Predicted SEED Role

"Copper resistance protein D" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MDL8 at UniProt or InterPro

Protein Sequence (309 amino acids)

>H281DRAFT_04217 putative copper resistance protein D (Paraburkholderia bryophila 376MFSha3.1)
MSIDGLWIGQVAMAALMNVAFAFAVGSALLGAWLANDAKAKVAPGRAAWLRAQRSMLTAS
VVLVLADLGWLLYQAASMSGVALPAAFAFVPTVLTQTHVGYGWSIAFAGALVLLGTAMTA
HSGMLRNALLWLAVIAIAAGKASLGHAVDAGPASAAIAMQTLHVLVTSVWAGLAITAGLA
VLPALGLSTARGILIRTATQVSNVSVVAVGFVLLSGIFNAVRGSGGSFEAIGSSTWGHVL
ILKLSLVGLALVLGGLNRFLALPRLRRTASTMDAHTFTNVLYLEALAMIGVLVAAAALSH
SVPAFAMVN