Protein Info for H281DRAFT_04209 in Paraburkholderia bryophila 376MFSha3.1

Annotation: two component transcriptional regulator, winged helix family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00072: Response_reg
  • amino acids 20 to 130 (111 residues), 99.3 bits, E=1.5e-32
• PF00486: Trans_reg_C
  • amino acids 163 to 235 (73 residues), 76 bits, E=2e-25

Best Hits

Swiss-Prot: 42% identical to PMRA_PECPM: Transcriptional regulatory protein PmrA (pmrA) from Pectobacterium parmentieri

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 90% identity to bxe:Bxe_A0670)

Predicted SEED Role

No annotation

Protein Sequence (279 amino acids)

>H281DRAFT_04209 two component transcriptional regulator, winged helix family (Paraburkholderia bryophila 376MFSha3.1)
VRRGDTRGAGQALSWRTMRILIAEDDSILADGLVRSLRQSAYAVDHVKSGVEADTALSMQ
SFDLLILDLGLPRMSGLEVLRRLRARNSNLPVLILTAADSVDERVKGLDLGADDYMAKPF
ALNELEARVRALTRRGAGGGPTVVRHGSLSFDQVGRIAYINEQVIELSARELGLLEVLLQ
RIGRLVSKEQLVDHLCEWGEEVSNNAIEVYVHRLRKKIEPSGVRIITVRGLGYCLEKAVA
PANLNTTAAASAPAEPEPEPPSSPSSPQSDGMPASHHYK