Protein Info for H281DRAFT_04204 in Paraburkholderia bryophila 376MFSha3.1

Annotation: succinyl-CoA synthetase (ADP-forming) alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01019: succinate-CoA ligase, alpha subunit
  • amino acids 3 to 293 (291 residues), 412.6 bits, E=4.4e-128
• PF02629: CoA_binding
  • amino acids 6 to 102 (97 residues), 81.1 bits, E=1.3e-26
• PF13607: Succ_CoA_lig
  • amino acids 150 to 291 (142 residues), 35 bits, E=1.7e-12
• PF00549: Ligase_CoA
  • amino acids 156 to 269 (114 residues), 80.4 bits, E=2e-26

Best Hits

Swiss-Prot: 63% identical to SUCD_BACSU: Succinate--CoA ligase [ADP-forming] subunit alpha (sucD) from Bacillus subtilis (strain 168)

KEGG orthology group: K01902, succinyl-CoA synthetase alpha subunit [EC: 6.2.1.5] (inferred from 99% identity to bug:BC1001_2939)

MetaCyc: 85% identical to 3-sulfinopropionyl-CoA synthetase alpha subunit (Advenella mimigardefordensis DPN7)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]; 6.2.1.- [EC: 6.2.1.5]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (21/26 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (14/17 steps found)
• adipate degradation (5/5 steps found)
• pyruvate fermentation to acetate V (3/3 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• adipate biosynthesis (4/5 steps found)
• superpathway of glyoxylate bypass and TCA (9/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (16/22 steps found)
• pyruvate fermentation to acetate VI (2/3 steps found)
• TCA cycle I (prokaryotic) (7/10 steps found)
• TCA cycle III (animals) (7/10 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• TCA cycle VIII (Chlamydia) (4/6 steps found)
• TCA cycle II (plants and fungi) (6/9 steps found)
• methylaspartate cycle (12/19 steps found)
• 3,3'-disulfanediyldipropannoate degradation (1/4 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• reductive TCA cycle II (6/12 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (24/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• C5-Branched dibasic acid metabolism
• Citrate cycle (TCA cycle)
• Propanoate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5

Use Curated BLAST to search for 6.2.1.5

Sequence Analysis Tools

See A0A2Z5ME20 at UniProt or InterPro

Protein Sequence (293 amino acids)

>H281DRAFT_04204 succinyl-CoA synthetase (ADP-forming) alpha subunit (Paraburkholderia bryophila 376MFSha3.1)
MSILINKDTKVITQGITGKTGQFHTRACREYANGREAYVAGVNPKRAGEDFEGIPIYASV
AEAKAETGATVSVIYVPPAGAAAAIWEAVEADLDLAICITEGIPVRDMIEIKDRMRRENR
KTLLLGPNCPGTITPDELKIGIMPGHIHRKGRIGVVSRSGTLTYEAVGQLTAIGLGQSSA
VGIGGDPINGLKHIDVMKMFNDDPETDAVIMIGEIGGPDEANAAEWIKGNMKKPVVGFIA
GVTAPPGKRMGHAGALISGGADTAEAKLEIMDACGIKVTKNPSEMARLLKAML