Protein Info for H281DRAFT_04203 in Paraburkholderia bryophila 376MFSha3.1

Annotation: integral membrane protein, YjbE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details TIGR03717: integral membrane protein, YjbE family" amino acids 12 to 191 (180 residues), 236.1 bits, see alignment E=1.1e-74 PF03741: TerC" amino acids 15 to 190 (176 residues), 172.2 bits, see alignment E=4.9e-55

Best Hits

KEGG orthology group: None (inferred from 95% identity to bug:BC1001_2938)

Predicted SEED Role

"Membrane protein TerC, possibly involved in tellurium resistance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MFD2 at UniProt or InterPro

Protein Sequence (236 amino acids)

>H281DRAFT_04203 integral membrane protein, YjbE family (Paraburkholderia bryophila 376MFSha3.1)
MFEFLATLHWGAVIQIIVIDILLGGDNAVVIALACRNLPPAQRTKGVLWGTAGAILLRVV
LIAFAVALLDVPLLKFAGGLLLLWIGVRLMAPAHDAHENVKPADKLISAIKTIIVADAVM
SLDNVIAIAGAAEAADPQHRLALVIFGLVVSIPLIVWGSQLVLKLLDRYPIVITLGAALL
GWIAGGLIINDPAGDRWPVLDTPVAEYGMSIAGALFVVILGYLIKRRNANRAAAQH