Protein Info for H281DRAFT_04199 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Putative Zn-dependent protease, contains TPR repeats

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 622 transmembrane" amino acids 275 to 293 (19 residues), see Phobius details PF01435: Peptidase_M48" amino acids 189 to 379 (191 residues), 113 bits, see alignment E=7.8e-37

Best Hits

KEGG orthology group: None (inferred from 87% identity to bgf:BC1003_2872)

Predicted SEED Role

"Exported zinc metalloprotease YfgC precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MDD2 at UniProt or InterPro

Protein Sequence (622 amino acids)

>H281DRAFT_04199 Putative Zn-dependent protease, contains TPR repeats (Paraburkholderia bryophila 376MFSha3.1)
LHERDGSAQRLITIAACPLILDCLSLSEGRRFPIPSYELAMRPNRFLAALLCVALAAPPE
AFAQARAASGVAPVVTQSAEPPLVSGPVESYSNPMVPPEIAQGVFGVYGGAESRFSGNFG
LNRGAGNSTGGGSNDGWRAPIAAQQLPDLGSGGSGSLTPPAERKLGERVMRDLRRDPDYL
DDWLVRDYLNSVAAKLAAAANALYIGGYRPDFDLFAVRDTQINAFSLPGGFIGVNTGLIV
ATQTESELASVLGHEMGHVLQRHISRMITAGERSTYAALASMLFGVLAGVLAHSGDLGSA
IAFGGQAYAVDNQLRFSRSAEHEADRVGFLLLAGAGYDPYSMITFFGRLDRAAMSDTGIP
AYARTHPLTGERIADMEDRARRAPYRQPHQAAEYGFVRARARLLQDRSRSEYADEISRMR
SEIEDRTALNIAANWYGIAFGQMLLERYDDAAASLASSRAAFAAVTQATSDAARSSPNLD
VLAADIARRAGHDDEAVRLADLAQKRWPQSHAAIDMHIRTLLTLRRFTEAQALAQKETQA
QPDQPTWWLYLAQASVGTGDALTRRRALAEKFALEGAWPSAIRQLKDARDMKTIGYYDLA
TVDARLHEMEKRYQEERLDEKG