Protein Info for H281DRAFT_04192 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Predicted branched-chain amino acid permease (azaleucine resistance)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 108 to 122 (15 residues), see Phobius details amino acids 138 to 164 (27 residues), see Phobius details amino acids 176 to 206 (31 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details PF03591: AzlC" amino acids 22 to 164 (143 residues), 110.7 bits, see alignment E=4e-36

Best Hits

KEGG orthology group: None (inferred from 93% identity to bug:BC1001_2927)

Predicted SEED Role

"Branched-chain amino acid transport protein AzlC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MDJ5 at UniProt or InterPro

Protein Sequence (248 amino acids)

>H281DRAFT_04192 Predicted branched-chain amino acid permease (azaleucine resistance) (Paraburkholderia bryophila 376MFSha3.1)
MLARLSDIDRRAFREGARDYSPTLMAICSWGLVTGIAMSKSVLTLPQALAMSLLCYAGSS
QLAVLPLLAAKLPVWTVLLTAAMVNMRFVIFSVGLAPHFSYLSMWRRISLGYFNGDVIYL
LFVKKNFPTGYVPGKEAYFWGMAVSSWLSWQVASIAGILLASLIPDNWGLALAGTLALLP
IMVAAIATRSTLVAVGIAGVVSLLAFDLPYRLALPLAVIAAIIAGSAADLMVERADLRRI
RGGAGDSR