Protein Info for H281DRAFT_04189 in Paraburkholderia bryophila 376MFSha3.1

Annotation: pyruvate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01064: pyruvate kinase
  • amino acids 3 to 474 (472 residues), 521.1 bits, E=1.2e-160
• PF00224: PK
  • amino acids 3 to 327 (325 residues), 376.2 bits, E=1.4e-116
• PF02887: PK_C
  • amino acids 360 to 472 (113 residues), 113.1 bits, E=8e-37

Best Hits

Swiss-Prot: 52% identical to KPYK2_ECOLI: Pyruvate kinase II (pykA) from Escherichia coli (strain K12)

KEGG orthology group: K00873, pyruvate kinase [EC: 2.7.1.40] (inferred from 98% identity to bgf:BC1003_2862)

MetaCyc: 52% identical to pyruvate kinase 2 (Escherichia coli K-12 substr. MG1655)
Pyruvate kinase. [EC: 2.7.1.40]

Predicted SEED Role

"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• Bifidobacterium shunt (14/15 steps found)
• heterolactic fermentation (16/18 steps found)
• Rubisco shunt (10/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (21/26 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (7/7 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (14/17 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (8/9 steps found)
• mixed acid fermentation (13/16 steps found)
• homolactic fermentation (10/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (16/22 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• glycolysis IV (7/10 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (6/9 steps found)
• glycerol degradation to butanol (11/16 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis
• Purine metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.40

Sequence Analysis Tools

See A0A2Z5MFU7 at UniProt or InterPro

Protein Sequence (478 amino acids)

>H281DRAFT_04189 pyruvate kinase (Paraburkholderia bryophila 376MFSha3.1)
MHRATKIVATIGPASSTPEILLQMIQAGADVVRLNFSHGTADDHRQRAEFVREAARQAGR
EVAIMADLQGPKIRVGKFENGKVSLVAGEPFILDADCELGNQERAGLDYKDLPRDLKPGD
VLLLNDGLIVLNVQRVIGNEIHTIVKIGGDLSNNKGINRQGGGLSAPALTAKDMEDIRTA
MSLGVDFVAVSFPKNATDMEMARQLANIAGAPYGIKPKMIAKIERAEAIPALQGILDASD
GIMVARGDLAVEVGNAAVPALQKRMIRMARESNKFVITATQMMESMIYAPVPTRAEVSDV
ANAVLDGTDAVMLSAESAAGKYPVQTIETMAAICVEAEKSEQSELDRDFLDRTFTRIDQS
IAMGALFTAFHLGAKAIVALTESGSTALWMSRHWTHVPIFALTPRVGSERAMALYRNVTS
LHLDTNTDRDTALQQALETVVSKGYASRGDMVVLTVGEPMGQAGGTNTLKIVRVGEPY