Protein Info for H281DRAFT_04163 in Paraburkholderia bryophila 376MFSha3.1

Annotation: zinc/manganese transport system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF00005: ABC_tran" amino acids 39 to 183 (145 residues), 97 bits, see alignment E=1.6e-31 PF13304: AAA_21" amino acids 140 to 215 (76 residues), 28.3 bits, see alignment E=1.7e-10

Best Hits

KEGG orthology group: K02074, zinc/manganese transport system ATP-binding protein (inferred from 91% identity to bpy:Bphyt_3250)

Predicted SEED Role

"Zinc ABC transporter, ATP-binding protein ZnuC" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>H281DRAFT_04163 zinc/manganese transport system ATP-binding protein (Paraburkholderia bryophila 376MFSha3.1)
MNVTGRSTPANLSASAASRAPVLEVDHVTLELGDRTILRDAGFVVNQGEFIGVLGPNGAG
KTTLMRAVLGLVPAASGSIRVLGQPVERGNASIGYMPQTRSALAGRRVRGRDFVAMAADG
HRWGLPHADARTRADVERVLELVDGRKLAERPLSELSGGERQRLLLAQCLLGAPKLLLLD
EPLISLDPHHQKSVVELVRRVQQELGIAVLFSAHELNPLLNSLDRVLYLGSGVAALGTVD
EVITRPVLSRLYGSPIDVMRVNGRIFVMSGGVEVEKHDHEHEHDGNGGHSHSHGHSHGPA
HGHSHQHDSRDGHKHDV