Protein Info for H281DRAFT_04158 in Paraburkholderia bryophila 376MFSha3.1

Annotation: sorbitol ABC transporter membrane protein /mannitol ABC transporter membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 29 to 54 (26 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 277 to 301 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 102 to 306 (205 residues), 66.6 bits, see alignment E=1.3e-22

Best Hits

KEGG orthology group: K10228, sorbitol/mannitol transport system permease protein (inferred from 98% identity to bgf:BC1003_2830)

MetaCyc: 60% identical to polyol ABC-type transporter permease component MtlF (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, permease component 1" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MF92 at UniProt or InterPro

Protein Sequence (311 amino acids)

>H281DRAFT_04158 sorbitol ABC transporter membrane protein /mannitol ABC transporter membrane protein (Paraburkholderia bryophila 376MFSha3.1)
MRPLRLPLMHAHPQTEKEREVRKANSARWLVSPSVAVLLLWMTIPLAMTIWFSFSRYNLL
NPDLKGFAGFDNYQFLASDPSFGPSIGHTLQLIVSVLVITVVGGVLMAILFDRKFYGQGV
ARLLAIAPFFVMPTVSALIWKNMILHPVYGLVASGMRAIGLQPIDWFAEYPLTAVIMIVA
WQWLPFAFLILFTAIQSLDQEQKEAARIDGAGPFSMFFYITLPHLKRAIAVVVMMETIFL
LSIFAEIYTTTGGGPGTATTNLSYLIYSLGLQQFDVGLASAGGILAVVLANIVSFFLVRM
LAKNLKGEYEK