Protein Info for H281DRAFT_04152 in Paraburkholderia bryophila 376MFSha3.1

Annotation: D-arabinitol 4-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 PF01232: Mannitol_dh" amino acids 14 to 176 (163 residues), 117.2 bits, see alignment E=8e-38 PF08125: Mannitol_dh_C" amino acids 205 to 444 (240 residues), 264.1 bits, see alignment E=1.3e-82

Best Hits

Swiss-Prot: 72% identical to DALD_RALSO: D-arabinitol 4-dehydrogenase (dalD) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00007, D-arabinitol 4-dehydrogenase [EC: 1.1.1.11] (inferred from 95% identity to bug:BC1001_2888)

Predicted SEED Role

"D-arabinitol 4-dehydrogenase (EC 1.1.1.11)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5ME27 at UniProt or InterPro

Protein Sequence (470 amino acids)

>H281DRAFT_04152 D-arabinitol 4-dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
MSSGQDSGAAAHVILHIGAGSFHRAHQAWYLHRLNEANLPGEPHWSLTVGNIRSDMNAVL
EALAAQDGVYTLETVTPQGERAYETIRSIERVVPWTESLDALIEAGADPACKIISFTVTE
GGYYLDEHDQLDTANPDLSTDLKGGHTTIYGALAAILEARMKNGAGPVTLQTCDNLRRNG
ERFHAGMSAFLELRGAGELAQWFDDNTACPSSMVDRITPRPTPDVRERVKAATGVDDACP
VMGEAFIQWVIEERFIAGRPAWEKVGAELVDSVLPYEEAKIRILNATHSCIAWAGTLVGL
NYIHEGTQDADIRKFAFDYVTEDVIPCLSPSPLDLERYRDVVLERFGNPYIQDTNQRVAA
DGFSKLPGFIAPTLAECFERGVTPAATAMLPALFFRFLERWQAGTLPYTYQDGVMDERVA
RRFFAAPDPLQAFAADRLLWGSMAQTPELESALAGALARVDVWLAKRAHA