Protein Info for H281DRAFT_04126 in Paraburkholderia bryophila 376MFSha3.1

Annotation: integrase/recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF02899: Phage_int_SAM_1" amino acids 29 to 110 (82 residues), 68.1 bits, see alignment E=6.6e-23 TIGR02225: tyrosine recombinase XerD" amino acids 31 to 316 (286 residues), 368.6 bits, see alignment E=1.1e-114 PF00589: Phage_integrase" amino acids 133 to 304 (172 residues), 164.6 bits, see alignment E=2e-52

Best Hits

Swiss-Prot: 68% identical to XERD_RALSO: Tyrosine recombinase XerD (xerD) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 95% identity to bug:BC1001_2861)

Predicted SEED Role

"Tyrosine recombinase XerD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>H281DRAFT_04126 integrase/recombinase XerD (Paraburkholderia bryophila 376MFSha3.1)
MSDTLVEDASAQPPSPLSSPLFATSSASIDAFCDALWLEHGLSRNTLDAYRRDLRLFSEW
LAQTRNASLDTASEADLNAYSAARQKDKSTSANRRLSVFRRYYGWAVREHRAKVDPTLRI
RSAKQPPRFPSTLSEAQVEALLGAPDIETALGLRDRTMLELMYASGLRVTELVTLKTVEV
GLNEGVVRVMGKGSKERLIPFGEEAHGWIERYLRDARPALLGPRAADALFVTSRAEGMTR
QQFWNIIKRHAAVAGVHAPLSPHTLRHAFATHLLNHGADLRVVQLLLGHTDISTTQIYTH
VARERLKSLHAQHHPRG