Protein Info for H281DRAFT_04121 in Paraburkholderia bryophila 376MFSha3.1

Annotation: UDP-N-acetylmuramate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase
  • amino acids 15 to 344 (330 residues), 236.7 bits, E=1.7e-74
• PF01565: FAD_binding_4
  • amino acids 32 to 160 (129 residues), 79.2 bits, E=2.5e-26
• PF02873: MurB_C
  • amino acids 225 to 348 (124 residues), 103.4 bits, E=6.3e-34

Best Hits

Swiss-Prot: 85% identical to MURB_PARPJ: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 86% identity to bug:BC1001_2856)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan recycling I (10/14 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

See A0A2Z5MD49 at UniProt or InterPro

Protein Sequence (348 amino acids)

>H281DRAFT_04121 UDP-N-acetylmuramate dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
MSHTDSAEFVAGYPLKAHNTFGFDVRSQWACRIEREAQLLAAVRDPRAAGLPRLVLGGGS
NVVLTDDFAGLVLLVALRGRRIVREDADAVYVEAAAGEPWHDFVAWTLAQGLPGLENLAL
IPGTVGAAPIQNIGAYGLEMCERFASLRAVELASGKTVEFDAHACAFGYRDSFFKREGRD
RFVITSVVFRLPKAWQPRAGYADLARELAANGYAANGEQPDAKAIFDAVVAVRRAKLPDP
LELGNAGSFFKNPVIDAAQFEALKSSEPDVISYAQPDGRVKLAAGWMIDRCGWKGRALGA
AGVHERQALVLVNRGGASGADVLALARAIQRDVQARFGVELEAEPVCV