Protein Info for H281DRAFT_04114 in Paraburkholderia bryophila 376MFSha3.1

Annotation: NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00106: adh_short" amino acids 7 to 196 (190 residues), 153.9 bits, see alignment E=7.9e-49 PF08659: KR" amino acids 8 to 161 (154 residues), 29.8 bits, see alignment E=1.1e-10 PF01370: Epimerase" amino acids 9 to 125 (117 residues), 21.8 bits, see alignment E=2.2e-08 PF13561: adh_short_C2" amino acids 14 to 245 (232 residues), 138 bits, see alignment E=8.2e-44

Best Hits

Swiss-Prot: 59% identical to HCD2_DROME: 3-hydroxyacyl-CoA dehydrogenase type-2 (scu) from Drosophila melanogaster

KEGG orthology group: None (inferred from 96% identity to bgf:BC1003_2786)

MetaCyc: 62% identical to 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (Pseudomonas putida)
3-hydroxy-2-methylbutyryl-CoA dehydrogenase. [EC: 1.1.1.178]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.178

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MDS5 at UniProt or InterPro

Protein Sequence (252 amino acids)

>H281DRAFT_04114 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family (Paraburkholderia bryophila 376MFSha3.1)
MEIRDNVFLITGGASGLGAATARLLAENGGKVVLADLNQDAGEALAKELGGIFVKCDVSR
EDDATQAVAAATKLGMLRGLVNCAGVAPAVKTVGKDGPHPLDSFTRTISINLIGTFNMIR
LAATAMSKNEPNANGERGVIINTASVAAYDGQIGQAAYAASKGGVVGMTLPIARDLSRNA
IRVMTIAPGIFETPMLLGMPQEVQDALGAMVPFPPRLGKPAEYAMLAKQIFDNPMLNGEV
IRLDGAIRMQPK