Protein Info for H281DRAFT_04112 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR00466: 3-deoxy-D-manno-octulosonate cytidylyltransferase" amino acids 11 to 257 (247 residues), 279.2 bits, see alignment E=1.3e-87 PF02348: CTP_transf_3" amino acids 12 to 238 (227 residues), 197.1 bits, see alignment E=3.5e-62 PF12804: NTP_transf_3" amino acids 25 to 136 (112 residues), 44.1 bits, see alignment E=2.5e-15

Best Hits

Swiss-Prot: 90% identical to KDSB_PARXL: 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K00979, 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC: 2.7.7.38] (inferred from 95% identity to bug:BC1001_2847)

Predicted SEED Role

"3-deoxy-manno-octulosonate cytidylyltransferase (EC 2.7.7.38)" in subsystem KDO2-Lipid A biosynthesis (EC 2.7.7.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MFL2 at UniProt or InterPro

Protein Sequence (266 amino acids)

>H281DRAFT_04112 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) (Paraburkholderia bryophila 376MFSha3.1)
MNHTNPATPPFIAVVPARLASSRLPNKPLADIGGKPMVVRVAERARESGAQQVLIASDAQ
SVLDAASEHGFDSVLTRADHPSGTDRLAEVASQFGWSDETIVVNVQGDEPLIDPALVCGV
ASHLAARNDCAIATAAHPIVDAAEIFNPNVVKVVLDARGVALYFSRAPIPWARDAYQPHW
PDVALMPVPPAPAVVHRHIGLYAYRAKFLRTYPDLAISPIEQVEALEQLRAMWHGERIAV
LITPEVPLPGVDTPADLARVRALFGS