Protein Info for H281DRAFT_04109 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Exodeoxyribonuclease VII large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF13742: tRNA_anti_2" amino acids 20 to 111 (92 residues), 105.2 bits, see alignment E=2.7e-34 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 21 to 359 (339 residues), 418.5 bits, see alignment E=1.5e-129 PF01336: tRNA_anti-codon" amino acids 39 to 111 (73 residues), 50.2 bits, see alignment E=3e-17 PF02601: Exonuc_VII_L" amino acids 135 to 446 (312 residues), 353.5 bits, see alignment E=2e-109

Best Hits

Swiss-Prot: 57% identical to EX7L_HERAR: Exodeoxyribonuclease 7 large subunit (xseA) from Herminiimonas arsenicoxydans

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 95% identity to bgf:BC1003_2780)

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MEP7 at UniProt or InterPro

Protein Sequence (459 amino acids)

>H281DRAFT_04109 Exodeoxyribonuclease VII large subunit (Paraburkholderia bryophila 376MFSha3.1)
MNSDSSFNSPTLPGGEVVVPVSALNRAIGTMLERSFPLVWVAGEVSNFTRAASGHWYFSI
KDAQAQMRCVMFRGRAQYAEFMPKEGDRIEVRALVTMYEPRGELQLNVEAVRRTGQGRLY
EAFLRLKAQLEAEGLFAAERKRALPSHPRAIGIVTSLQAAALRDVLTTLLRRAPHIPVIV
YPAPVQGVGASAKLAAMVDAASARREVDVLIVCRGGGSIEDLWAFNEEVLARAIAESAVP
VVSGVGHETDFTIADFAADMRAPTPTGAAELVSPQRVLLLRDLDHRHAALARGFGRMMER
RAQQLDWLARRLVSPAERLARQRMHLQQLSARLSSAGARPVRDARARFSLLHMRWQRWRP
DLAAHQAKLDNLTQRLDAALLRQHERQVARISTLAARLEVLSPQRTLERGYAAVLDAQTG
RAVRAPSSLKPGRRLTVHLAEGTADVALADVQPRLADGF