Protein Info for H281DRAFT_04092 in Paraburkholderia bryophila 376MFSha3.1

Annotation: peptide/nickel transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 23 to 47 (25 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 152 to 177 (26 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 253 to 277 (25 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 20 to 95 (76 residues), 35.4 bits, see alignment E=1.1e-12 PF00528: BPD_transp_1" amino acids 131 to 330 (200 residues), 121 bits, see alignment E=5.2e-39

Best Hits

Swiss-Prot: 37% identical to GSIC_ECOL6: Glutathione transport system permease protein GsiC (gsiC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 94% identity to bug:BC1001_2827)

MetaCyc: 37% identical to glutathione ABC transporter membrane subunit GsiC (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"ABC transporter binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MF33 at UniProt or InterPro

Protein Sequence (335 amino acids)

>H281DRAFT_04092 peptide/nickel transport system permease protein (Paraburkholderia bryophila 376MFSha3.1)
MSTTVSSPASTPKGNAGRVVRFLATRVGLSLITLWLLSVIVFAGGQLLPGDIGRAVLGPL
ADARAVAALNHQLGADRPLTTQYVEWISHFVRGDMGLSYAYREPVRPFIADALAHSAKLG
LLAFIVVVPLGIAGGVWSAMHAGRWLDRTISIAGLSATVVPEFVSSIVLILVFGVWLRWL
PIEAAYAPDAGPLEQLRHLILPVLPLVLVFFGYIARMARAGTVEALDADYTRTAILKGLP
RHTVIWRHVLRNALLPTITVAATQLGYMIGGLVVVETLFHYQGIGSLIYNAAKAKDFPML
EAGVLTVGVVYTVANLVADALHVLLNPRLRVRSAE