Protein Info for H281DRAFT_04078 in Paraburkholderia bryophila 376MFSha3.1

Annotation: signal peptidase II Aspartic peptidase. MEROPS family A08

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 transmembrane" amino acids 19 to 36 (18 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 22 to 166 (145 residues), 138.7 bits, see alignment E=8.2e-45 PF01252: Peptidase_A8" amino acids 25 to 165 (141 residues), 152.5 bits, see alignment E=4.5e-49

Best Hits

Swiss-Prot: 94% identical to LSPA_PARPJ: Lipoprotein signal peptidase (lspA) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 98% identity to bug:BC1001_2806)

MetaCyc: 43% identical to lipoprotein signal peptidase (Escherichia coli K-12 substr. MG1655)
Signal peptidase II. [EC: 3.4.23.36]

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MFP2 at UniProt or InterPro

Protein Sequence (172 amino acids)

>H281DRAFT_04078 signal peptidase II Aspartic peptidase. MEROPS family A08 (Paraburkholderia bryophila 376MFSha3.1)
MARTMAKTTSKASAGNSSLAPWLGVALIVILFDQLTKIAVQKVFAYGVAHEVTSFFNLIL
VYNRGAAFSFLAMAGGWQRWAFTALGVVAALVICYLLKRHGGQKMFCTALALILGGALGN
VIDRLAYGHVIDFLDFHVRAWHWPAFNLADSAITVGAILLVIDELRRVRGSR