Protein Info for H281DRAFT_04071 in Paraburkholderia bryophila 376MFSha3.1

Annotation: quinolinate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 TIGR00550: quinolinate synthetase complex, A subunit" amino acids 58 to 368 (311 residues), 351.3 bits, see alignment E=2.2e-109 PF02445: NadA" amino acids 60 to 367 (308 residues), 343.5 bits, see alignment E=4.8e-107

Best Hits

Swiss-Prot: 90% identical to NADA_BURL3: Quinolinate synthase A (nadA) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 96% identity to bpy:Bphyt_3153)

MetaCyc: 65% identical to quinolinate synthase (Escherichia coli K-12 substr. MG1655)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MG99 at UniProt or InterPro

Protein Sequence (395 amino acids)

>H281DRAFT_04071 quinolinate synthetase (Paraburkholderia bryophila 376MFSha3.1)
MTRWVFHGGKARAEEIMDQQAIRAVEYDRPQAQGTSCGIGQAWAKVPEVPSAQEKVALKE
RIRALLKREKAVLVAHYYVDAELQELADETGGCVADSLEMARFGRDHEAQTLVVAGVRFM
GETAKILSPDKRILMPDLDATCSLDLGCPVDEFSAFCDAHPDRTVVVYANTSAAVKARAD
WMVTSSIGLEIVADLHARGEKIIWAPDRHLGGYIQNKTGADMLMWQGSCLVHDEFKGIEL
DLLRAEYLGAKVLVHPESPANVVAQADVVGSTTQLIDAAQKLDATHFIVATDLGILHKMQ
LAAPGKTLIAAPTAGNSATCKSCAHCPWMAMNGLANLADVLERGHNEIFVERAVGERARV
PIDRMLDFAARHKKRVQASGDLARDAQLYSNVGAA