Protein Info for H281DRAFT_04070 in Paraburkholderia bryophila 376MFSha3.1

Annotation: nicotinate-nucleotide pyrophosphorylase [carboxylating]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)
  • amino acids 45 to 308 (264 residues), 284.5 bits, E=3.6e-89
• PF02749: QRPTase_N
  • amino acids 53 to 141 (89 residues), 81.5 bits, E=3.7e-27
• PF01729: QRPTase_C
  • amino acids 143 to 307 (165 residues), 173.5 bits, E=3.3e-55

Best Hits

Swiss-Prot: 55% identical to NADC_PSEAE: Nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 91% identity to bgf:BC1003_2736)

MetaCyc: 50% identical to quinolinate phosphoribosyltransferase (decarboxylating) (Escherichia coli K-12 substr. MG1655)
Nicotinate-nucleotide diphosphorylase (carboxylating). [EC: 2.4.2.19]

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD de novo biosynthesis III (6/6 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD de novo biosynthesis II (from tryptophan) (7/9 steps found)
• superpathway of NAD biosynthesis in eukaryotes (8/14 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Sequence Analysis Tools

See A0A2Z5MD71 at UniProt or InterPro

Protein Sequence (309 amino acids)

>H281DRAFT_04070 nicotinate-nucleotide pyrophosphorylase [carboxylating] (Paraburkholderia bryophila 376MFSha3.1)
MTAAAQSSAVPRSAPYSHAEAVSPLFAEIHAQYGAVFDAALARNVADALAEDVGTGDQTG
RLVPADDVRRARVVVREDAVLCGVSWFNAVLRQVDSRIEVQWLYREGDRMTADTPVCELR
GPVRALLTAERNALNFLQLLSGVASATRRYVDAVAHTRTRILDTRKTLPGLRLAQKYAVR
VGGGANQRLALYDGILIKENHIAAAGGVGAAMDAALALNAGVSIQIEVETLEQLETALAH
RAESVLLDNFSFDSMREAVRITAGRAVLEVSGGVNFETVRTIAETGVDRVSIGALTKDVR
ATDYSLRIV