Protein Info for H281DRAFT_04069 in Paraburkholderia bryophila 376MFSha3.1

Annotation: L-aspartate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00551: L-aspartate oxidase" amino acids 2 to 511 (510 residues), 654 bits, see alignment E=7e-201 PF01266: DAO" amino acids 4 to 101 (98 residues), 31.8 bits, see alignment E=2.3e-11 PF00890: FAD_binding_2" amino acids 4 to 383 (380 residues), 360.8 bits, see alignment E=2.5e-111 PF02910: Succ_DH_flav_C" amino acids 432 to 512 (81 residues), 50 bits, see alignment E=5.9e-17

Best Hits

KEGG orthology group: K00278, L-aspartate oxidase [EC: 1.4.3.16] (inferred from 97% identity to bug:BC1001_2797)

Predicted SEED Role

"L-aspartate oxidase (EC 1.4.3.16)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 1.4.3.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MD79 at UniProt or InterPro

Protein Sequence (532 amino acids)

>H281DRAFT_04069 L-aspartate oxidase (Paraburkholderia bryophila 376MFSha3.1)
MEFDVAIVGSGLAGLSVALNLAQTRRVAVIAKRSITEGASDWAQGGIAAVLDSADSIENH
VRDTLVAGAGLCDEAATRFIVEHGRAAIEWLIEQGVPFTKDDSAELGFHLTREGGHSHRR
IIHAADATGHAVVATLSERVRQHPNITLLEDHYAIDLITSDRLGLPGRRCHGLYALDVES
GRTVTIEAPHTVLATGGAGKVYLYTTNPDTATGDGIAMAWRAGCRVSNMEFIQFHPTCLF
HPYAKSFLISEAVRGEGGVLKLPDGTRFMPNHDERAELAPRDIVARAIDFEIKKRGIDCV
YLDISHQPADFLREHFPTILARCLEFGIDITKEPIPVVPAAHYTCGGVVTDLAGRTDLAG
LYAVGETSCTGLHGANRLASNSLLECLVLGRSAARAIEEEGFCGAVHAPLPDWDESRVSD
PDEEVVVAHNWDELRRLMWNYVGIVRTDKRLARAKHRLALLRDEIHEYYANFKVSRDLLE
LRNLVDVASLIVDGARSRRESRGLHFSRDWPATLPKALPTVLSPEHVRNRNV