Protein Info for H281DRAFT_04058 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Acetyltransferase, GNAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF00583: Acetyltransf_1" amino acids 36 to 136 (101 residues), 67.1 bits, see alignment E=5.1e-22 PF13673: Acetyltransf_10" amino acids 47 to 139 (93 residues), 38.2 bits, see alignment E=4.2e-13 PF12568: PanZ" amino acids 49 to 139 (91 residues), 25.9 bits, see alignment E=1.9e-09 PF13508: Acetyltransf_7" amino acids 56 to 137 (82 residues), 55.7 bits, see alignment E=1.6e-18 PF13480: Acetyltransf_6" amino acids 57 to 118 (62 residues), 24.6 bits, see alignment E=7.4e-09 PF08445: FR47" amino acids 79 to 139 (61 residues), 28.8 bits, see alignment E=3e-10

Best Hits

Swiss-Prot: 41% identical to Y1169_YERE8: Acetyltransferase YE1169 (YE1169) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: None (inferred from 86% identity to bpy:Bphyt_3140)

Predicted SEED Role

"Acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>H281DRAFT_04058 Acetyltransferase, GNAT family (Paraburkholderia bryophila 376MFSha3.1)
MTTTASATLSIRRFDASDTDNVVALWQQAFPEYRDVTKPQRNPHLSIANKLAMQPELFFV
AVLGERVVGTVMGGYDGHRGWLYSLAVDESVRRHGIGSRLVAHVEDALTALGCPKLNLQV
LSAKSDVRAFYEALGYRADAVVSFGKRLGELADSPPV