Protein Info for H281DRAFT_04052 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Predicted arabinose efflux permease, MFS family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 84 to 128 (45 residues), see Phobius details amino acids 162 to 169 (8 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 315 to 338 (24 residues), see Phobius details amino acids 381 to 403 (23 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 366 (346 residues), 109.1 bits, see alignment E=2.3e-35 PF05977: MFS_3" amino acids 45 to 400 (356 residues), 114.4 bits, see alignment E=5.1e-37

Best Hits

KEGG orthology group: None (inferred from 89% identity to bpy:Bphyt_3134)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>H281DRAFT_04052 Predicted arabinose efflux permease, MFS family (Paraburkholderia bryophila 376MFSha3.1)
MHASPSSTRVRLPAAFQRLAWSNLVAQSAEQISLAAAPLVAVFALGADARGTGLLQTAQT
LPFLLLSIPLGVWADRRSRRTLMALAESVRVVAMLCVLLLLMTHALSLPLLAALGFVAAT
GTVAYNVAAPSLVPSLVSRETYASANGRLELARSVAYSAGPALGGLLVGWIGAGWAYGCA
AALSALAVGLLAGLREPSRAATPARHFMVELREGTRFVLRDSLLLPMLATAVFFNLGFFV
LQAVYVPYAVHRLGLSASAVGITLGAYGVGMVCGALAAPAVARRLAFGRVLLIGPSCGLL
ASLVMVGTLVAPSFWLALLSFFLLGAGPILWVVGSTTLRQAITPQRMMGRVSALNSTATY
GARPAGALLGAAISARWNMDACLIAAAVAFFVQASIIAMSPAARLAAIPDERVTAC