Protein Info for H281DRAFT_04049 in Paraburkholderia bryophila 376MFSha3.1

Annotation: glutathione transport system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 640 PF00005: ABC_tran" amino acids 41 to 205 (165 residues), 94.4 bits, see alignment E=3.1e-30 amino acids 361 to 511 (151 residues), 118.8 bits, see alignment E=8.6e-38 PF08352: oligo_HPY" amino acids 256 to 288 (33 residues), 30.5 bits, see alignment (E = 1.2e-10) amino acids 563 to 597 (35 residues), 34.2 bits, see alignment (E = 7.7e-12)

Best Hits

KEGG orthology group: K13892, glutathione transport system ATP-binding protein (inferred from 96% identity to bgf:BC1003_2716)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MI63 at UniProt or InterPro

Protein Sequence (640 amino acids)

>H281DRAFT_04049 glutathione transport system ATP-binding protein (Paraburkholderia bryophila 376MFSha3.1)
VPTSSHTASPITGNLPTQRVLAVDNLSVAFRSGETTFNAVRNLSLMVERGETLAIVGESG
SGKSVTSLALMRLIEHGGGRLAGGSIAFRRRDGSVLDLAKASSGTMRSIRGADIAMIFQE
PMTSLNPVFTVGDQISEAISLHQGKSRSAAFAETLRLLELVRIPEARRVAARFPHQLSGG
MRQRVMIAMALSCKPALLIADEPTTALDVTIQAQILQLIRGLQDEMNMGVIFITHDMGVV
AEVADRVLVMYRGEKVEEGASDALFAAPSHPYTKALLAAVPRLGAMQGTDQPAKFPILTV
EQAGASGADEPVRPAAAVAKEAQPHVDESTPPILRVRDLVTRFPVRTGLFGRLTGRVHAV
EKVSFDLRPGETLALVGESGCGKSTTGRSLLRLVESQSGSIEFDGKEISSLTGPALQALR
RDIQFIFQDPFASLNPRLTVGFSIMEPLLVHGVAQGAEAQARVAWLLEKVGLPPEAARRY
PHEFSGGQRQRIAIARALALNPKVVIADESVSALDVSVQAQIVNLMLDLQRELGVAYLFI
SHDMAVVERVSHRVAVMYLGQIVEIGPRRAVFEAPQHPYTRKLMGAVPVADPARRHAKRM
LAADEIPSPIRSLNDEPAVAPLVAVGPGHFVAQHRVGGAY