Protein Info for H281DRAFT_04044 in Paraburkholderia bryophila 376MFSha3.1

Annotation: D-aminopeptidase DppA. Metallo peptidase. MEROPS family M55

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 85 to 105 (21 residues), see Phobius details PF04951: Peptidase_M55" amino acids 1 to 267 (267 residues), 314.4 bits, see alignment E=3.1e-98

Best Hits

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 93% identity to bug:BC1001_2773)

Predicted SEED Role

"D-aminopeptidase dipeptide-binding protein DppA (EC 3.4.11.-)" (EC 3.4.11.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.-

Use Curated BLAST to search for 3.4.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MDL6 at UniProt or InterPro

Protein Sequence (277 amino acids)

>H281DRAFT_04044 D-aminopeptidase DppA. Metallo peptidase. MEROPS family M55 (Paraburkholderia bryophila 376MFSha3.1)
MKVLISADIEGIAGVFHPEQTRSGNGEYEAARRWMTLEANAAIEGAFAGGATQVWVNDSH
GGFRNLLPDLLDPRAQVVLGKPRTLGMMAGLEYGAALVFMIGYHAMSQTRGILAHTINSF
AFARVSLNGEEVGEAGLYGALAEEYGAQVALLSGDDVFADETAPRFPGARFVVTKSATGH
ASGVTQSPASARAAIESAAREVVQQHLANGHPSQATRGAAKPVECELRVQTSALADLFCQ
WPTITRVDAVTLRFGAESAEHAVRMLNCLSAMSFMLR